Nr5a2 Rabbit Polyclonal Antibody

CAT#: TA329958

Rabbit Polyclonal Anti-Nr5a2 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "Nr5a2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Nr5a2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LDYTVCNYPQQTEKFGQLLLRLPEIRAISKQAEDYLYYKHVNGDVPYNNL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 64 kDa
Gene Name nuclear receptor subfamily 5, group A, member 2
Background Nr5a2 binds to promoters containing the sequence element 5'-AACGACCGACCTTGAG-3'.Nr5a2 plays a role in the regulation of gene expression in liver and pancreas. Nr5a2 may play a role in embryonic development.
Synonyms B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta; hB1F; hB1F-2; LRH-1; LRH1
Note Immunogen sequence homology: Rat: 100%; Mouse: 100%; Zebrafish: 83%; Dog: 79%; Pig: 79%; Horse: 79%; Human: 79%; Sheep: 79%; Bovine: 79%; Rabbit: 79%; Guinea pig: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.