TLR6 Rabbit Polyclonal Antibody

CAT#: TA329400

Rabbit Polyclonal anti-TLR6 antibody

Product Images

WB Suggested Anti-TLR6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Jurkat cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TLR6 antibody: synthetic peptide directed towards the middle region of human TLR6. Synthetic peptide located within the following region: KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: toll like receptor 6
• Database Link:
  NP_006059
  Entrez Gene 10333 Human
  UniProt ID Q9Y2C9
• Background: TLR6 is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor functionally interacts with toll-like receptor 2 to mediate cellular response to bacterial lipoproteins.
• Synonyms: CD286
• Note: Immunogen sequence homology: Human: 100%; Sheep: 86%; Goat: 85%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Toll-like receptor signaling pathway