SUPT16H Rabbit Polyclonal Antibody

CAT#: TA329319

Rabbit Polyclonal anti-SUPT16H antibody

Product Images

WB Suggested Anti-SUPT16H Antibody Titration: 1.25ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysateSUPT16H is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SUPT16H antibody: synthetic peptide directed towards the N terminal of human SUPT16H. Synthetic peptide located within the following region: ASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 66 kDa
• Gene Name: SPT16 homolog, facilitates chromatin remodeling subunit
• Database Link:
  NP_009123
  Entrez Gene 11198 Human
  UniProt ID Q9Y5B9
• Background: Transcription of protein-coding genes can be reconstituted on naked DNA with only the general transcription factors and RNA polymerase II. However, this minimal system cannot transcribe DNA packaged into chromatin, indicating that accessory factors may facilitate access to DNA. One such factor, FACT (facilitates chromatin transcription), interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT is composed of an 80 kDa subunit and a 140 kDa subunit, the latter of which is SUPT16H.
• Synonyms: CDC68; FACTP140; SPT16
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Mouse: 93%; Bovine: 93%; Zebrafish: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors