TCFL5 Rabbit Polyclonal Antibody
Frequently bought together (1)
Other products for "TCFL5"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TCFL5 antibody: synthetic peptide directed towards the middle region of human TCFL5. Synthetic peptide located within the following region: TLIRHPSELMNVPLQQQNKCTALVKNKTAATTTALQFTYPLFTTNACSTS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 53 kDa |
Gene Name | transcription factor like 5 |
Database Link | |
Background | TCFL5 is a new bHLH transcription factor that negatively regulates upstream transcription factor-dependent transcription. |
Synonyms | bHLHe82; CHA; E2BP-1; Figlb; SOSF1 |
Note | Immunogen sequence homology: Human: 100%; Rat: 93%; Mouse: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.