NFIL3 Rabbit Polyclonal Antibody

CAT#: TA329213

Rabbit Polyclonal anti-NFIL3 antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of nuclear factor, interleukin 3 regulated (NFIL3)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "NFIL3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NFIL3 antibody: synthetic peptide directed towards the middle region of human NFIL3. Synthetic peptide located within the following region: GYSHSPPLLQVNRSSSNSPRTSETDDGVVGKSSDGEDEQQVPKGPIHSPV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 51 kDa
Gene Name nuclear factor, interleukin 3 regulated
Background NFIL3 is a basic leucine zipper (bZIP) transcription factor that represses or activates transcription in non-osteoblastic cells. NFIL3 play a role in attenuation of PTH target gene transcription in osteoblasts. NFIL3 repression domain interacts specifically with the TBP binding repressor protein Dr1.Glucocorticoid-mediated upregulation of the bZIP transcriptional repressor gene, NFIL3, is dependent on [Ca2+]i levels, and correlates with Glucocorticoid-evoked apoptosis of Glucocorticoid-sensitive CEM-C7-14 cells. NFIL3 is involved in a distinct growth factor-regulated signaling pathway that is responsible for the survival of early B-cell progenitors, and whose alteration by E2A-HLF leads to childhood B lineage leukemia.
Synonyms E4BP4; IL3BP1; NF-IL3A; NFIL3A
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 85%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.