DYRK3 Rabbit Polyclonal Antibody

CAT#: TA329166

Rabbit Polyclonal anti-DYRK3 antibody

Product Images

WB Suggested Anti-DYRK3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: THP-1 cell lysate

• 

  Sample Type : HeLa cells Primary Antibody Dilution : 1:50 Secondary Antibody : Gaot anti-rabbit-Alexa Fluor Secondary Antibody Dilution : 1:250 Color/Signal Descriptions : Green: DYRK3 Red: PABP1 Blue: DAPIGene Name : DYRK3Submitted by : Frank Wippich, Institute of Molecular Life Sciences, University of Zurich

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: IF, WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DYRK3 antibody: synthetic peptide directed towards the N terminal of human DYRK3. Synthetic peptide located within the following region: GDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 66 kDa
• Gene Name: dual specificity tyrosine phosphorylation regulated kinase 3
• Database Link:
  NP_001004023
  Entrez Gene 8444 Human
  UniProt ID O43781
• Background: This gene product belongs to the DYRK family of dual-specificity protein kinases that catalyze autophosphorylation on serine/threonine and tyrosine residues. The members of this family share structural similarity, however, differ in their substrate specificity, suggesting their involvement in different cellular functions. The encoded protein has been shown to autophosphorylate on tyrosine residue and catalyze phosphorylation of histones H3 and H2B in vitro. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Synonyms: DYRK5; hYAK3-2; RED; REDK
• Note: Immunogen sequence homology: Human: 100%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase