Kcna1 Rabbit Polyclonal Antibody

CAT#: TA328928

Rabbit polyclonal Anti-KV1.1


USD 905.00

3 Weeks*

Size
    • 50 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "Kcna1"

Specifications

Product Data
Applications WB
Recommended Dilution WB: 1:200-1:2000; IHC: 1:100-1:3000
Reactivities Human, Mouse, Rat
Host Rabbit
Clonality Polyclonal
Immunogen GST fusion protein with sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGN CTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416-495 of mouse Kv1.1, (MW: 36 kDa.).Intracellular, C-terminus.
Formulation Lyophilized. Concentration before lyophilization ~0.8mg/ml (lot dependent, please refer to CoA along with shipment for actual concentration). Buffer before lyophilization: phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3.
Reconstitution Method Add 50 ul double distilled water (DDW) to the lyophilized powder.
Purification The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and from antibodies cross-reactive to Kv1.2 by affinity chromatography on immobilized KV1.2-GST-fusion protein, and then the antibody was affinity purified on immo
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Gene Name potassium voltage-gated channel, shaker-related subfamily, member 1
Background KV1.1 is a mammalian voltage dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.1 was the first mammalian KV channel to be cloned from mouse brain.1 Eight Shaker related genes exist in mammals constituting the KV1, subfamily of the large KV channel family of genes. A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.The structure of KV1.1 channel is similar to all KV channels and includes six membrane spanning helixes creating a voltage sensor domain and a pore domain. The channel is expressed in neurons and cardiac and skeletal muscle tissue as well as in retina and pancreas.2 The functional channel is considered low voltage activated and shows very little inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle. Mutations in the coding of KV1.1 gene were discovered in Episodic Ataxia patients.
Synonyms AEMK; EA1; HBK1; HUK1; HUKI; Kv1.1; MBK1; MGC126782; MGC138385; MK1; RBK1
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.