CASK Mouse Monoclonal Antibody [Clone ID: K56A/50]
Other products for "CASK"
Specifications
Product Data | |
Clone Name | K56A/50 |
Applications | IHC, IP, WB |
Recommended Dilution | Immunoblot (IB) Immunohistochemistry (IHC) Immunoprecipitation (IP) |
Reactivities | Human, Mouse, Rat, Xenopus, Zebrafish |
Host | Mouse |
Isotype | IgG1 |
Clonality | Monoclonal |
Immunogen | Fusion protein amino acids 318-415 (first L27 domain, NSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEE) of human Peripheral plasma membrane protein CASK (also known as Calcium/calmodulin-dependent serine protein kinase, Protein lin-2 homolog and LIN2, accession number O14936) Rat: 100% identity (98/98 amino acids identical) Mouse: 100% identity (98/98 amino acids identical) |
Formulation | State: Purified |
Conjugation | Unconjugated |
Gene Name | calcium/calmodulin dependent serine protein kinase |
Database Link | |
Synonyms | Lin-2 homolog, LIN2 |
Note | USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows: "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616." Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity. View Research License Agreement |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.