Serine racemase (SRR) (NM_021947) Human Recombinant Protein

CAT#: TP310359

Recombinant protein of human serine racemase (SRR), 20 µg

Product Images

• 

  Coomassie blue staining of purified SRR protein (Cat# TP310359). The protein was produced from HEK293T cells transfected with SRR cDNA clone (Cat# RC210359) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210359 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPD
  ALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAK
  RVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAE
  PSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKL
  LIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 36.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: SRR Facilitates D-serine Production from L-serine: In vitro assays, Purified human SRR (TP310359) converts L-serine to D-serine in a dose and time dependent manner. Y-axis is pmol of D-serine produced.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_068766
• Locus ID: 63826
• UniProt ID: Q9GZT4, Q3ZK31, Q8N3F4
• Cytogenetics: 17p13.3
• Refseq Size: 2477
• Refseq ORF: 1020
• Synonyms: ILV1; ISO1
• Summary: Catalyzes the synthesis of D-serine from L-serine. D-serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Glycine, serine and threonine metabolism