TPX2 (NM_012112) Human Recombinant Protein

CAT#: TP305821

Recombinant protein of human TPX2, microtubule-associated, homolog (Xenopus laevis) (TPX2), 20 µg

Product Images

• 

  Coomassie blue staining of purified TPX2 protein (Cat# TP305821). The protein was produced from HEK293T cells transfected with TPX2 cDNA clone (Cat# RC205821) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205821 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLENKLLGKNGTGGLFQGKTPLRKANLQQAI
  VTPLKPVDNTYYKEAEKENLVEQSIPSNACSSLEVEAAISRKTPAQPQRRSLRLSAQKDLEQKEKHHVKM
  KAKRCATPVIIDEILPSKKMKVSNNKKKPEEEGSAHQDTAEKNASSPEKAKGRHTVPCMPPAKQKFLKST
  EEQELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKE
  VNFTSELRKHPSSPARVTKGCTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKDD
  INLLPSKSSVTKICRDPQTPVLQTKHRARAVTCKSTAELEAEELEKLQQYKFKARELDPRILEGGPILPK
  KPPVKPPTEPIGFDLEIEKRIQERESKKKTEDEHFEFHSRPCPTKILEDVVGVPEKKVLPITVPKSPAFA
  LKNRIRMPTKEDEEEDEPVVIKAQPVPHYGVPFKPQIPEARTVEICPFSFDSRDKERQLQKEKKIKELQK
  GEVPKFKALPLPHFDTINLPEKKVKNVTQIEPFCLETDRRGALKAQTWKHQLEEELRQQKEAACFKARPN
  TVISQEPFVPKKEKKSVAEGLSGSLVQEPFQLATEKRAKERQELEKRMAEVEAQKAQQLEEARLQEEEQK
  KEELARLRRELVHKANPIRKYQGLEIKSSDQPLTVPVSPKFSTRFHC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 85.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: TPX2 activity in a microtubule binding assay: SAF-A binds to MT in a TPX2-dependent manner. MT binding analysis of isolated SAF-A protein in the presence of different amounts of recombinant TPX2 protein. The lower panel shows western blotting with anti-SAF-A antibody. SAF-A co-pelleted with MT was increased, dependent on the amount of TPX2. S, supernatant; P,pellet.
  
  Nan Ma, Sachihiro Matsunaga, Kiichi Fukui, et al. J. Cell Science. 124, 394-404. 2011.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036244
• Locus ID: 22974
• UniProt ID: Q9ULW0, Q643R0
• Cytogenetics: 20q11.21
• Refseq Size: 3685
• Refseq ORF: 2241
• Synonyms: C20orf1; C20orf2; DIL-2; DIL2; FLS353; GD:C20orf1; HCA519; HCTP4; p100; REPP86
• Summary: Spindle assembly factor required for normal assembly of mitotic spindles. Required for normal assembly of microtubules during apoptosis. Required for chromatin and/or kinetochore dependent microtubule nucleation. Mediates AURKA localization to spindle microtubules (PubMed:18663142, PubMed:19208764). Activates AURKA by promoting its autophosphorylation at 'Thr-288' and protects this residue against dephosphorylation (PubMed:18663142, PubMed:19208764). TPX2 is inactivated upon binding to importin-alpha (PubMed:26165940). At the onset of mitosis, GOLGA2 interacts with importin-alpha, liberating TPX2 from importin-alpha, allowing TPX2 to activates AURKA kinase and stimulates local microtubule nucleation (PubMed:26165940).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Stem cell - Pluripotency