TSSK1 (TSSK1B) (NM_032028) Human Recombinant Protein

CAT#: TP305395

Recombinant protein of human testis-specific serine kinase 1B (TSSK1B), 20 µg

Product Images

• 

  Coomassie blue staining of purified TSSK1B protein (Cat# TP305395). The protein was produced from HEK293T cells transfected with TSSK1B cDNA clone (Cat# RC205395) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205395 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDDAAVLKRRGYLLGINLGEGSYAKVKSAYSERLKFNVAIKIIDRKKAPADFLEKFLPREIEILAMLNHC
  SIIKTYEIFETSHGKVYIVMELAVQGDLLELIKTRGALHEDEARKKFHQLSLAIKYCHDLDVVHRDLKCD
  NLLLDKDFNIKLSDFSFSKRCLRDDSGRMALSKTFCGSPAYAAPEVLQGIPYQPKVYDIWSLGVILYIMV
  CGSMPYDDSNIKKMLRIQKEHRVNFPRSKHLTGECKDLIYHMLQPDVNRRLHIDEILSHCWMQPKARGSP
  SVAINKEGESSRGTEPLWTPEPGSDKKSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPST
  METEEGPPQQPPETRAQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 41.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: TSSK1B activity verified in a biochemical assay: TSSK1B (testis-specific serine kinase 1B) (TP305395) activity was measured in a homogeneous time-resolved fluorescent (HTRF®) assay. TSSK1B is a serine/threonine kinase that is highly expressed in testis and may be involved in a signaling pathway during male germ cell development or mature sperm function. Varying concentrations of TSSK1B were added to a reaction mix containing ATP and a biotinylated kinase substrate and the reaction mixture was incubated to allow the protein to phosphorylate the substrate. HTRF detection reagents were then added, and the time-resolved fluorescent signal was measured on a Flexstation 3 microplate reader. The time resolved fluorescent signal is expressed as “delta R” or “ΔR” and is a ratio calculated from the fluorescent emission intensities of the donor and acceptor fluors.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_114417
• Locus ID: 83942
• UniProt ID: Q9BXA7, A0ZT98
• Cytogenetics: 5q22.2
• Refseq Size: 2478
• Refseq ORF: 1101
• Synonyms: FKSG81; SPOGA4; STK22D; TSK1; TSSK1
• Summary: TSSK1 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).[supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome, Protein Kinase