TDO2 (NM_005651) Human Recombinant Protein

CAT#: TP302777

Recombinant protein of human tryptophan 2,3-dioxygenase (TDO2), 20 µg

Product Images

• 

  Coomassie blue staining of purified TDO2 protein (Cat# TP302777). The protein was produced from HEK293T cells transfected with TDO2 cDNA clone (Cat# RC202777) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202777 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEH
  LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDF
  NDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLE
  RTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKG
  ERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHY
  LRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 47.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Bioactivity: The specific activity of TDO2 was determined by monitoring Kynurenine formation from the N-formylkynurenine based on the absorbance at 492nm. The N-formylkynurenine was produced from a conversion of tryptophan with TDO2. The reactions were carried out at 37°C for 40min in 100ul of the reaction volume containing 200mM PBS, pH7.5, 1mM ascorbic acid, and 1.25mM L-tryptophan as the substrate with various amounts of TDO2. The reaction was terminated by adding 50ul of 30% (w/v) trichloroacetic acid. The sample was further incubated for 30min at 60°C and centrifuged at 12000 rpm for 15 min. The supernatant was used to mix with an equal volume of Ehrlich's reagent (2% p-dimethylaminobenza-ldehyde in glacial acetic acid) to measure the absorbance at 492 nm after 10min incubation
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005642
• Locus ID: 6999
• UniProt ID: P48775
• Cytogenetics: 4q32.1
• Refseq Size: 1703
• Refseq ORF: 1218
• Synonyms: HYPTRP; TDO; TO; TPH2; TRPO
• Summary: This gene encodes a heme enzyme that plays a critical role in tryptophan metabolism by catalyzing the first and rate-limiting step of the kynurenine pathway. Increased activity of the encoded protein and subsequent kynurenine production may also play a role in cancer through the suppression of antitumor immune responses, and single nucleotide polymorphisms in this gene may be associated with autism. [provided by RefSeq, Feb 2012]
• Protein Pathways: Metabolic pathways, Tryptophan metabolism