Antibodies

View as table Download

Rabbit Polyclonal Anti-VARS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VARS2 antibody: synthetic peptide directed towards the middle region of human VARS2. Synthetic peptide located within the following region: LERRFSRVQEVVQVLRALRATYQLTKARPRVLLQSSEPGDQGLFEAFLEP

VARS2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 864-1063 of human VARS2 (NP_065175.4).
Modifications Unmodified