APCS mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
APCS mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
APCS mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) APCS mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) APCS mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) APCS mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
APCS mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
In Stock
APCS mouse monoclonal antibody,clone 5A9, Biotinylated
Applications | IF, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
5 Days
APCS mouse monoclonal antibody,clone 1D6, Biotinylated
Applications | IF, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
5 Days
APCS mouse monoclonal antibody,clone 1D6, HRP conjugated
Applications | IF, WB |
Reactivities | Human |
Conjugation | HRP |
USD 509.00
5 Days
APCS mouse monoclonal antibody,clone 1H2, Biotinylated
Applications | IF, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
5 Days
APCS mouse monoclonal antibody,clone 1H2, HRP conjugated
Applications | IF, WB |
Reactivities | Human |
Conjugation | HRP |
USD 509.00
5 Days
APCS mouse monoclonal antibody,clone 5A9, HRP conjugated
Applications | IF, WB |
Reactivities | Human |
Conjugation | HRP |
Serum Amyloid P (APCS) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 151-178 amino acids from the C-terminal region of Human APCS |
Rabbit Polyclonal Anti-APCS Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-APCS antibody: synthetic peptide directed towards the N terminal of human APCS. Synthetic peptide located within the following region: NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT |
Rabbit anti-APCS Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human APCS |