Antibodies

Jump to Filters
View as table Download
SCD1 (SCD) Mouse Monoclonal Antibody [Clone ID: CD.E10]
TA309938

USD 380.00

2 Weeks

Mouse anti-SCD1 (Stearoyl-CoA desaturase) monoclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
TA309938 is a replacement of AM20836PU-N.
SCD1 (SCD) Rabbit Polyclonal Antibody
TA331172

USD 485.00

5 Days

Rabbit Polyclonal Anti-SCD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCD antibody: synthetic peptide directed towards the middle region of human SCD. Synthetic peptide located within the following region: HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG
SCD1 (SCD) Rabbit Polyclonal Antibody
TA309846

USD 550.00

5 Days

Rabbit Polyclonal SCD Antibody

Applications ICC/IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human protein (within residues 50-100). [Swiss-Prot# O00767]
SCD1 (SCD) (C-term) Goat Polyclonal Antibody
AP22447PU-N

USD 520.00

5 Days

SCD1 (SCD) (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, FC, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RIKRTGDGNYKSG, from the C Terminus of the protein sequence according to NP_005054.3.