Recoverin (RCVRN) (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human Recoverin. |
Rabbit polyclonal anti-Recoverin antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Recoverin. |
Rabbit Polyclonal Anti-RCVRN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RCVRN antibody: synthetic peptide directed towards the C terminal of human RCVRN. Synthetic peptide located within the following region: DVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLI |
Rabbit Polyclonal Anti-RCVRN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RCVRN antibody: synthetic peptide directed towards the N terminal of human RCVRN. Synthetic peptide located within the following region: GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQS |
Rabbit Polyclonal Anti-RCV1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RCV1 Antibody: synthetic peptide directed towards the C terminal of human RCV1. Synthetic peptide located within the following region: KMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANK |
Germany
Japan
United Kingdom
China
