Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-RPLP0 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPLP0 antibody: synthetic peptide directed towards the N terminal of human RPLP0. Synthetic peptide located within the following region: TEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITT |
RPLP0 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human RPLP0 |
Rabbit Polyclonal Anti-RPLP0 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPLP0 antibody: synthetic peptide directed towards the middle region of human RPLP0. Synthetic peptide located within the following region: PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY |
RPLP0 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RPLP0 |
Active filters
Target Symbol
- RPLP0