Goat Polyclonal Antibody against PAM
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DQEKEDDGSESEE, from the C Terminus of the protein sequence according to NP_000910.2; NP_620121.1; NP_620176.1; NP_620177.1. |
Rabbit Polyclonal Anti-PAM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PAM Antibody: synthetic peptide directed towards the N terminal of human PAM. Synthetic peptide located within the following region: PKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPL |
PAM Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human PAM |
Germany
Japan
United Kingdom
China