Germany
Japan
United Kingdom
China
NFE2L2 mouse monoclonal antibody, clone OTI8A10 (formerly 8A10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
USD 509.00
In Stock
NFE2L2 mouse monoclonal antibody, clone OTI8A10 (formerly 8A10), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 509.00
In Stock
NFE2L2 mouse monoclonal antibody, clone OTI8A10 (formerly 8A10), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Carrier-free (BSA/glycerol-free) NFE2L2 mouse monoclonal antibody, clone OTI8A10 (formerly 8A10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NFE2L2 mouse monoclonal antibody, clone OTI8A10 (formerly 8A10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Goat Anti-NRF2 (aa445-458) Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KHSSRLEAHLTRDE, from the internal region of the protein sequence according to NP_006155.2; NP_001138884.1; NP_001138885.1. |
Rabbit Polyclonal Nrf2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Nrf2 |
Rabbit Polyclonal Anti-NFE2L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFE2L2 antibody: synthetic peptide directed towards the C terminal of human NFE2L2. Synthetic peptide located within the following region: KEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGN |
NFE2L2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NFE2L2 |
Rabbit Polyclonal Anti-NFE2L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NFE2L2 antibody is: synthetic peptide directed towards the C-terminal region of Human NFE2L2. Synthetic peptide located within the following region: VSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHSVESSSYGD |
Rabbit Polyclonal Anti-Nfe2l2 Antibody
| Applications | WB |
| Reactivities | Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Nfe2l2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Nfe2l2. Synthetic peptide located within the following region: DLIDILWRQDIDLGVSREVFDFSQRQKDYELEKQKKLEKERQEQLQKEQE |
Rabbit Polyclonal Anti-Nrf2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Nrf2 Antibody: A synthesized peptide derived from human Nrf2 |
NFE2L2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NFE2L2 |
Active filters
Target Symbol
- NRF2