Germany
Japan
United Kingdom
China
Antibodies
View as table Download
MYL12B rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to the 10-40 of Human MYL9. |
Rabbit Polyclonal Anti-MYL12B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MYL12B Antibody is: synthetic peptide directed towards the C-terminal region of Human MYL12B. Synthetic peptide located within the following region: EKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDE |
Rabbit Polyclonal Anti-MRLC2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRLC2 Antibody: A synthesized peptide derived from human MRLC2 |
Rabbit Polyclonal Anti-Myosin regulatory light chain 2 (Phospho-Ser18) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Myosin regulatory light chain 2 (Phospho-Ser18) Antibody: A synthesized peptide derived from human Myosin regulatory light chain 2 (Phospho-Ser18) |
| Modifications | Phospho-specific |
MYL12B rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MYL12B |
Active filters
Target Symbol
- MYL12B