Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 509.00
2 Weeks
MST1 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal antibody to STK4 (serine/threonine kinase 4)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Chicken, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 324 and 418 of STK4 (Uniprot ID#Q13043) |
MST1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MST1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
MST1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
MST1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit Polyclonal Anti-MST1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MST1 antibody: synthetic peptide directed towards the middle region of human MST1. Synthetic peptide located within the following region: SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE |
Rabbit Polyclonal MST1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
MST1 (+MST2) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 150-200 of Human MST1. |
Rabbit polyclonal Mst1/2 (Ab-183) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Mst1/Mst2 around the phosphorylation site of threonine 183 (R-N-TP-V-I). |
Active filters
Target Symbol
- MST1