Antibodies

Jump to Filters
View as table Download
IL33 Rabbit Polyclonal Antibody
AP32086PU-N

USD 465.00

2 Weeks

IL33 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived recombinant Human Interleukin 33 (Cat.-No AR20007PU)
IL33 Rabbit Polyclonal Antibody
AP32086PU-S

USD 345.00

2 Weeks

IL33 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived recombinant Human Interleukin 33 (Cat.-No AR20007PU)
IL33 Rabbit Polyclonal Antibody
AP32086BT-N

USD 465.00

2 Weeks

IL33 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) E.coli derived recombinant Human Interleukin 33 (Cat.-No AR20007PU)
IL33 Rabbit Polyclonal Antibody
AP32086BT-S

USD 345.00

2 Weeks

IL33 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) E.coli derived recombinant Human Interleukin 33 (Cat.-No AR20007PU)
IL33 Rabbit Polyclonal Antibody
TA368251

USD 380.00

4 Weeks

IL33 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL33
IL33 Mouse Monoclonal Antibody [Clone ID: 4E9]
AM09020PU-N

USD 430.00

3 Weeks

IL33 mouse monoclonal antibody, clone 4E9, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
IL33 Rabbit Polyclonal Antibody
AP08936PU-N

USD 500.00

2 Weeks

IL33 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated corresponding to a 19 amino acid peptide from near the center of Human IL33.
IL33 Rabbit Polyclonal Antibody
TA306448

USD 570.00

2 Weeks

Rabbit Polyclonal IL-33 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IL-33 antibody was raised against a 19 amino acid peptide from near the center of human IL-33.
IL33 Rabbit Polyclonal Antibody
TA306447

USD 570.00

5 Days

Rabbit Polyclonal IL-33 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-33 antibody was raised against a 19 amino acid peptide from near the amino terminus of human IL-33.
IL33 Mouse Monoclonal Antibody [Clone ID: 4E9]
AM09020PU-S

USD 315.00

3 Weeks

IL33 mouse monoclonal antibody, clone 4E9, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
IL33 Rabbit Polyclonal Antibody
TA339875

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL33 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL33 antibody: synthetic peptide directed towards the N terminal of human IL33. Synthetic peptide located within the following region: AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC
IL33 Rabbit Polyclonal Antibody
TA372490

USD 380.00

4 Weeks

IL33 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL33
IL33 Rabbit Polyclonal Antibody
TA377468

USD 365.00

3 Weeks

IL33 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 95-270 of human IL33 (NP_254274.1).
Modifications Unmodified
IL33 Rabbit Polyclonal Antibody
TA319222

USD 765.00

5 Days

Rabbit polyclonal anti-IL-33 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-33 protein.
IL33 Rabbit Polyclonal Antibody
TA319221

USD 740.00

5 Days

Rabbit polyclonal IL-33 antibody Peroxidase Conjugated

Applications WB
Reactivities Human
Conjugation Peroxidase
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-33 protein.