Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 509.00
2 Weeks
Anti-IDH3A mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
| Applications | FC, IF, WB |
| Reactivities | Human, Dog, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 509.00
2 Weeks
USD 509.00
2 Weeks
IDH3A Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 28-366 of human IDH3A (NP_005521.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-IDH3A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IDH3A antibody: synthetic peptide directed towards the N terminal of human IDH3A. Synthetic peptide located within the following region: MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK |
Active filters
Target Symbol
- IDH3A