Antibodies

Jump to Filters
View as table Download
IL36 gamma (IL36G) Mouse Monoclonal Antibody [Clone ID: OTI2F4]
TA505994

USD 478.00

In Stock

IL1F9 (IL36 gamma) mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
IL36 gamma (IL36G) Mouse Monoclonal Antibody [Clone ID: OTI2F4]
CF505994

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) IL1F9 mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
IL36 gamma (IL36G) Mouse Monoclonal Antibody [Clone ID: OTI6E4]
TA505995

USD 447.00

In Stock

IL1F9 (IL36 gamma) mouse monoclonal antibody, clone OTI6E4 (formerly 6E4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
IL36 gamma (IL36G) Mouse Monoclonal Antibody [Clone ID: OTI6E4]
CF505995

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) IL1F9 mouse monoclonal antibody, clone OTI6E4 (formerly 6E4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
IL36 gamma (IL36G) Rabbit Polyclonal Antibody
TA326667

USD 570.00

2 Weeks

Rabbit Polyclonal IL-36G Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-36G antibody was raised against a 13 amino acid peptide near the carboxy terminus of human IL-36G.
IL36 gamma (IL36G) Mouse Monoclonal Antibody [Clone ID: OTI2F4]
TA505994S

USD 200.00

2 Days

IL1F9 (IL36 gamma) mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

IL36 gamma (IL36G) Rabbit Polyclonal Antibody
TA308154

USD 625.00

In Stock

Rabbit Polyclonal antibody to IL1F9 (interleukin 1 family, member 9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 105 and 169 of IL1F9 (Uniprot ID#Q9NZH8)
IL36 gamma (IL36G) Mouse Monoclonal Antibody [Clone ID: OTI6E4]
TA505995S

USD 200.00

2 Days

IL1F9 (IL36 gamma) mouse monoclonal antibody, clone OTI6E4 (formerly 6E4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

IL36 gamma (IL36G) Rabbit Polyclonal Antibody
TA333744

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL36G Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL36G Antibody is: synthetic peptide directed towards the middle region of Human IL36G. Synthetic peptide located within the following region: ITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLY