Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against HSD11B1 / HDL
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CTSYNMDRFINK, from the C Terminus of the protein sequence according to NP_005516.1; NP_861420.1. |
Rabbit Polyclonal Anti-HSD11B1 Antibody
| Applications | IHC, WB |
| Reactivities | Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSD11B1 antibody: synthetic peptide directed towards the N terminal of human HSD11B1. Synthetic peptide located within the following region: QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI |
HSD11B1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-292 of human HSD11B1 (NP_005516.1). |
| Modifications | Unmodified |
Hsd11b1 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TARSEEGLQKVVSR, from the internal region of the protein sequence according to NP_032314.2. |
Active filters
Target Symbol
- HSD11B1