Antibodies

View as table Download

Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)

Applications FC, IF, WB
Reactivities Human, Dog, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HK2 mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)

Applications FC, IF, WB
Reactivities Human, Dog, Mouse, Rat
Conjugation Unconjugated

Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5), Biotinylated

Applications FC, IF, WB
Reactivities Human, Dog, Mouse, Rat
Conjugation Biotin

Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Dog, Mouse, Rat
Conjugation HRP

Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HK2 mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)

Applications FC, IF, WB
Reactivities Human, Dog, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit polyclonal HK2 (Hexokinase II) Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 453-483 amino acids from the Central region of human HK2 (Hexokinase II).

Rabbit Polyclonal Anti-HK2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HK2

Rabbit Polyclonal Anti-HK2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the N terminal of human HK2. Synthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG

Rabbit polyclonal HK2 (Hexokinase II) Antibody (N-term)

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Pig)
Conjugation Unconjugated
Immunogen This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-121 amino acids from the N-terminal region of human HK2 (Hexokinase II).

Rabbit Polyclonal Anti-HK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the middle region of human HK2. Synthetic peptide located within the following region: QRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFLR

Rabbit anti-HK2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HK2