Rabbit Polyclonal Anti-FOXL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXL1 antibody: synthetic peptide directed towards the N terminal of human FOXL1. Synthetic peptide located within the following region: HLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPPY |
Anti-FOXL1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 2-15 amino acids of Human forkhead box L1 |
Anti-FOXL1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 2-15 amino acids of Human forkhead box L1 |
Rabbit polyclonal anti-FOXL1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FOXL1. |
Rabbit Polyclonal anti-FOXL1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXL1 antibody: synthetic peptide directed towards the N terminal of human FOXL1. Synthetic peptide located within the following region: SHLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPP |
Rabbit Polyclonal Anti-FOXL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXL1 antibody: synthetic peptide directed towards the middle region of human FOXL1. Synthetic peptide located within the following region: EDAGDAAQGAAAVAVGQAARTGDGPGSPLRPASRSSPKSSDKSKSFSIDS |
Rabbit Polyclonal Anti-FOXL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXL1 Antibody: A synthesized peptide derived from human FOXL1 |
Germany
Japan
United Kingdom
China
