Goat Polyclonal Antibody against FOXL2
| Applications | IHC, PEP-ELISA, WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DSKTGALHSRLDL, from the C Terminus of the protein sequence according to NP_075555. |
Anti-FOXL2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 364-376 amino acids of Human forkhead box L2 |
Rabbit Polyclonal Anti-FOXL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FOXL2 Antibody: synthetic peptide directed towards the N terminal of human FOXL2. Synthetic peptide located within the following region: MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGGGGGGGTAPEKPD |
Foxl2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Rat |
Rabbit Polyclonal Anti-Foxl2 Antibody
| Reactivities | Rat |
| Conjugation | Unconjugated |
FOXL2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human FOXL2 |
Germany
Japan
United Kingdom
China
