Antibodies

View as table Download

Rabbit Polyclonal Anti-EXOC3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOC3 antibody: synthetic peptide directed towards the middle region of human EXOC3. Synthetic peptide located within the following region: LERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCF

EXOC3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 396-745 of human EXOC3 (NP_009208.2).
Modifications Unmodified