Germany
Japan
United Kingdom
China
Antibodies
View as table Download
EPX mouse monoclonal antibody, clone EPO104, Purified
| Applications | IF, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-EPX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPX antibody: synthetic peptide directed towards the middle region of human EPX. Synthetic peptide located within the following region: LAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDP |
EPX mouse monoclonal antibody, clone AHE-1, Purified
| Applications | IF, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
EPX Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human EPX (NP_000493.1). |
| Modifications | Unmodified |
EPX mouse monoclonal antibody, clone AHE-1, Purified
| Applications | IF, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
EPX mouse monoclonal antibody, clone EPO104, Purified
| Applications | IF, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- EPX