Germany
Japan
United Kingdom
China
Antibodies
View as table Download
DUSP14 (N-term) rabbit polyclonal antibody, Purified
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human DUSP14. |
Rabbit Polyclonal Anti-DUSP14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DUSP14 antibody is: synthetic peptide directed towards the C-terminal region of Human DUSP14. Synthetic peptide located within the following region: PVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPY |
DUSP14 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human DUSP14 |
Active filters
Target Symbol
- DUSP14