Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Cullin 1 (CUL1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 679-708 amino acids from the C-terminal region of human CUL1 |
Rabbit polyclonal anti-Cul1 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 766-776 of Human Cul1 (C-terminus) coupled to KLH. |
Rabbit Polyclonal Anti-CUL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CUL1 antibody: synthetic peptide directed towards the C terminal of human CUL1. Synthetic peptide located within the following region: HQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA |
Rabbit Polyclonal Anti-Cullin 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cullin 1 Antibody: A synthesized peptide derived from human Cullin 1 |
Active filters
Target Symbol
- CULLIN 1