Fgf2 (NM_008006) Mouse Recombinant Protein

CAT#: TP527549

Purified recombinant protein of Mouse fibroblast growth factor 2 (Fgf2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR227549 representing NM_008006
  Red=Cloning site Green=Tags(s)
  
  MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGV
  VSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGP
  GQKAILFLPMSAKS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 17.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_032032
• Locus ID: 14173
• UniProt ID: P15655, Q541T2
• Cytogenetics: 3 18.41 cM
• Refseq Size: 695
• Refseq ORF: 462
• Synonyms: bFGF; Fgf-2; Fgfb
• Summary: Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis.[UniProtKB/Swiss-Prot Function]