Erg (NM_133659) Mouse Recombinant Protein

CAT#: TP525536

Purified recombinant protein of Mouse ETS transcription factor (Erg), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Erg was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR225536 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MIQTVPDPAAHIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQAPAR
  VTIKMECNPSQVNGSRNSPDECSVNKGGKMVGSPDTVGMSYGSYMEEKHVPPPNMTTNERRVIVPADPTL
  WSTDHVRQWLEWAVKEYGLLDVDVLLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHL
  TSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVYPEATQRITTRPDLPYEPPRRSAWTGHSHLTPQSKAA
  QPSPSAVPKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTD
  PDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPS
  DLPYMGSYHAHPQKMNFVSPHPPALPVTSSSFFASPNPYWNSPTGGIYPNTRLPASHMPSHLGTYY
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 54.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_598420
• Locus ID: 13876
• UniProt ID: P81270
• Cytogenetics: 16 56.04 cM
• Refseq Size: 3259
• Refseq ORF: 1461
• Synonyms: D030036I24Rik
• Summary: Transcriptional regulator. May participate in transcriptional regulation through the recruitment of SETDB1 histone methyltransferase and subsequent modification of local chromatin structure.[UniProtKB/Swiss-Prot Function]