Padi4 (NM_011061) Mouse Recombinant Protein

CAT#: TP516758

Purified recombinant protein of Mouse peptidyl arginine deiminase, type IV (Padi4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR216758 representing NM_011061
  Red=Cloning site Green=Tags(s)
  
  MAQGAVIHVAPEQPTHAVCVVGTATPLDVRGSAPKGYTTFGITASPGVIVDVIHGPPVKKSTMGASKWPL
  DPELEVTLQVKAASSRTDDEKVRVSYYGPKTSPVQALIYITGVELSLSADVTRTGRVKPAQAGKDQSTWT
  WGPGGRGAILLVNCDKEDPQASGMDFEDDKILDNKDLQDMSPMTLSTKTPKDFFEKYQLVLEVPKAKMNR
  VRVFRATRGKLPSRYKVALGPQQFSYCLELPGGQHSTDFYVEGLAFPDADFKGLIPLTISLLDKSNPELP
  EALVFQDSVTFRVAPWIMTPNTQPPQEVYVCRVSDNEDFLKSLATLTKKAKCKLTVCPEEENIDDQWMQD
  EMEIGYIQAPHKTLPVVFDSPRDRGLKDFPVKRVMGPNFGYVTRKLYMSELTGLDAFGNLEVSPPVTVRG
  KEYPLGRILIGNSGYSSSESRDMHQALQDFLSAQQVQAPVRLFSDWLFVGHVDEFLSFVPARDKQGFRLL
  LSSPRACYQLFQELQSQGHGEATLFEGLKRKRQTINEILSNKKLRDQNAYVESCIDWNRAVLKRELGLAE
  GDIIDIPQLFKLAGNSRGNSKAQAFFPNMVNMLVLGKYLGIPKPFGPIIDGHCCLEEEVRSHLEPLGLHC
  TFINDFYTYHVYNGEVHCGTNVRRKPFTFKWWHMVP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 74.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_035191
• Locus ID: 18602
• UniProt ID: Q9Z183
• Cytogenetics: 4 72.34 cM
• Refseq Size: 2640
• Refseq ORF: 1998
• Synonyms: Pad4; Pdi4
• Summary: Catalyzes the citrullination/deimination of arginine residues of proteins such as histones, thereby playing a key role in histone code and regulation of stem cell maintenance. Citrullinates histone H1 at 'Arg-54' (to form H1R54ci), histone H3 at 'Arg-2', 'Arg-8', 'Arg-17' and/or 'Arg-26' (to form H3R2ci, H3R8ci, H3R17ci, H3R26ci, respectively) and histone H4 at 'Arg-3' (to form H4R3ci). Acts as a key regulator of stem cell maintenance by mediating citrullination of histone H1: citrullination of 'Arg-54' of histone H1 (H1R54ci) results in H1 displacement from chromatin and global chromatin decondensation, thereby promoting pluripotency and stem cell maintenance. Promotes profound chromatin decondensation during the innate immune response to infection in neutrophils by mediating formation of H1R54ci. Citrullination of histone H3 prevents their methylation by CARM1 and HRMT1L2/PRMT1 and represses transcription. Citrullinates EP300/P300 at 'Arg-2142', which favors its interaction with NCOA2/GRIP1.[UniProtKB/Swiss-Prot Function]