Acvr1c (NM_001033369) Mouse Recombinant Protein
CAT#: TP516726
Purified recombinant protein of Mouse activin A receptor, type IC (Acvr1c), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Acvr1c"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR216726 representing NM_001033369
Red=Cloning site Green=Tags(s) MLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTGLPLLVQRTIARTIVLQEI VGKGRFGEVWHGRWCGEDVAVKIFSSRDERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVS EYHEQGSLYDYLNRNIVTVAGMVKLALSIASGLAHLHMEIVGTQGKPAIAHRDIKSKNILVKKCDTCAIA DLGLAVKHDSIMNTIDIPQNPKVGTKRYMAPEMLDDTMNLSIFESFKRADIYSVGLVYWEIARRCSVGGV VEEYQLPYYDMVPSDPSIEEMRKVVCDQKLRPNLPNQWQSCEALRVMGRIMRECWYANGAARLTALRVKK TISQLCVKEDCKA myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 41.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001028541 |
Locus ID | 269275 |
UniProt ID | Q3V348 |
Cytogenetics | 2 C1.1 |
Refseq Size | 8666 |
Refseq ORF | 1089 |
Synonyms | ACTR-IC; ACVRLK7; Alk-7; ALK7; C230097P10 |
Summary | Serine/threonine protein kinase which forms a receptor complex on ligand binding. The receptor complex consisting of 2 type II and 2 type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators, SMAD2 and SMAD3. Receptor for activin AB, activin B and NODAL. Plays a role in cell differentiation, growth arrest and apoptosis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.