Camp (NM_009921) Mouse Recombinant Protein

CAT#: TP512132

Purified recombinant protein of Mouse cathelicidin antimicrobial peptide (Camp), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR212132 representing NM_009921
  Red=Cloning site Green=Tags(s)
  
  MQFQRDVPSLWLWRSLSLLLLLGLGFSQTPSYRDAVLRAVDDFNQQSLDTNLYRLLDLDPEPQGDEDPDT
  PKSVRFRVKETVCGKAERQLPEQCAFKEQGVVKQCMGAVTLNPAADSFDISCNEPGAQPFRFKKISRLAG
  LLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 19.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_034051
• Locus ID: 12796
• UniProt ID: P51437
• Cytogenetics: 9 59.8 cM
• Refseq Size: 582
• Refseq ORF: 516
• Synonyms: C; CAP; CAP18; CLP; Cnlp; Cr; Cramp; FAL; FALL39; MC; MCLP
• Summary: This gene encodes a member of the cathelicidin family of antimicrobial peptides that play an important role in the defense against microbial infection. The encoded preproprotein undergoes proteolytic processing to generate a mature polypeptide before secretion by host cells such as neutrophils, epithelial cells and macrophages. Mice lacking the encoded protein exhibit increased susceptibility to group A streptococcus and Escherichia coli infections. [provided by RefSeq, Oct 2015]