Arx (NM_007492) Mouse Recombinant Protein

CAT#: TP508926

Purified recombinant protein of Mouse aristaless related homeobox (Arx), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208926 representing NM_007492
  Red=Cloning site Green=Tags(s)
  
  MSNQYQEEGCSERPECKSKSPTLLSSYCIDSILGRRSPCKMRLLGAAQSLPAPLASRADQEKAMQGSPKS
  SSAPFEAELHLPPKLRRLYGPGGGRLLQGAAAAAAAAAAAAAAATATGTAGPRGEVPPPPPPAARPGERQ
  DSAGAVAAAAAAAAWDTLKISQAPQVSISRSKSYRENGAPFVPPPPALDELSGPGGVAHPEERLSAASGP
  GSAPAAGGGTGAEDDEEELLEDEEDEEEEEELLEDDDEELLEDDARALLKEPRRCSVATTGTVAAAAAAA
  AAAVATEGGELSPKEELLLHPEDAEGKDGEDSVCLSAGSDSEEGLLKRKQRRYRTTFTSYQLEELERAFQ
  KTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGAQTHPPGLPFPGPLSATHPLSPYLDASP
  FPPHHPALDSAWTAAAAAAAAAFPSLPPPPGSASLPPSGAPLGLSTFLGAAVFRHPAFISPAFGRLFSTM
  APLTSASTAAALLRQPTPAVEGAVASGALADPATAAADRRASSIAALRLKAKEHAAQLTQLNILPGTSTG
  KEVC
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 58.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_031518
• Locus ID: 11878
• UniProt ID: O35085
• Cytogenetics: X 41.05 cM
• Refseq Size: 2759
• Refseq ORF: 1692
• Synonyms: Ar; Arx1
• Summary: This gene encodes a transcription factor that plays an important role in the development of forebrain. Male mice lacking this gene have smaller brains, olfactory bulbs and testes, and die within half a day after birth. Mice lacking this gene specifically in ganglionic eminence-derived neurons, including cortical interneurons, develop seizures. Mutations in this gene have been demonstrated to cause mouse phenotypes resembling human X-linked lissencephaly and cognitive disability with epilepsy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]