Aldh7a1 (NM_001127338) Mouse Recombinant Protein

CAT#: TP508207

Purified recombinant protein of Mouse aldehyde dehydrogenase family 7, member A1 (Aldh7a1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug


USD 988.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "Aldh7a1"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR208207 protein sequence
Red=Cloning site Green=Tags(s)

MSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEVITTYCPANNEPIARVRQASLKDYEETIGKAKKA
WNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLVSLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPT
LPSERPGHALIEMWNPLGLVGIITAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVL
EDNLLPGAICSLVCGGADIGTTMARDERVNLLSFTGSTQVGKEVALMVQERFGKSLLELGGNNAIIAFED
ADLSLVVPSVLFAAVGTAGQRCTTVRRLFLHESIHNEVVDRLRSAYSQIRVGNPWDPNILYGPLHTKQAV
SMFVRAVEEAKKQGGTVVYGGKVMDHPGNYVEPTIVTGLAHDAPIVHQETFAPILYVFKFQDEEEVFEWN
NEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMR
RSTCTINYSTSLPLAQGIKFQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 55.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001120810
Locus ID 110695
UniProt ID Q9DBF1
Cytogenetics 18 30.55 cM
Refseq Size 3105
Refseq ORF 1536
Synonyms Atq1; D18Wsu181e
Summary Multifunctional enzyme mediating important protective effects. Metabolizes betaine aldehyde to betaine, an important cellular osmolyte and methyl donor. Protects cells from oxidative stress by metabolizing a number of lipid peroxidation-derived aldehydes. Involved in lysine catabolism (By similarity).[UniProtKB/Swiss-Prot Function]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.