Acvrl1 (NM_009612) Mouse Recombinant Protein

CAT#: TP508074

Purified recombinant protein of Mouse activin A receptor, type II-like 1 (Acvrl1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208074 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTLGSFRRGLLMLSVALGLTRGDLAKPSKLVNCTCESPHCKRPFCQGSWCTVVLVREQGRHPQVYRGCGS
  LNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAYLPLILGPVLALPVLVALGALGLW
  RVRRRQEKQRDLHSDLGESSLILKASEQADSMLGDFLDSDCTTGSGSGLPFLVQRTVARQVALVECVGKG
  RYGEVWRGSWHGESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHE
  HGSLYDFLQRQTLEPQLALRLAVSAACGLAHLHVEIFGTQGKPAIAHRDLKSRNVLVKSNLQCCIADLGL
  AVMHSQSSDYLDIGNNPRVGTKRYMAPEVLDEHIRTDCFESYKWTDIWAFGLVLWEIARRTIINGIVEDY
  KPPFYDMVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQK
  LSHNPEKPKVIH
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 56.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_033742
• Locus ID: 11482
• UniProt ID: Q61288
• Cytogenetics: 15 F1
• Refseq Size: 3640
• Refseq ORF: 1509
• Synonyms: Acvrlk1; AI115505; AI427544; Alk1
• Summary: Type I receptor for TGF-beta family ligands BMP9/GDF2 and BMP10 and important regulator of normal blood vessel development. On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. May bind activin as well.[UniProtKB/Swiss-Prot Function]