Banf1 (NM_001038231) Mouse Recombinant Protein

CAT#: TP500222

Purified recombinant protein of Mouse barrier to autointegration factor 1 (Banf1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200222 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTTSQKHRDFVAEPMGEKPVGSLAGIGDVLSKRLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGAN
  AKQSRDCFGCLREWCDAFL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 10.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001033320
• Locus ID: 23825
• UniProt ID: O54962
• Cytogenetics: 19 A
• Refseq Size: 766
• Refseq ORF: 270
• Synonyms: Baf; Bcrp1; L2bp1/Baf
• Summary: Plays fundamental roles in nuclear assembly, chromatin organization, gene expression and gonad development. May potently compress chromatin structure and be involved in membrane recruitment and chromatin decondensation during nuclear assembly. Contains 2 non-specific dsDNA-binding sites which may promote DNA cross-bridging.[UniProtKB/Swiss-Prot Function]