AKT1 (NM_001014432) Human Recombinant Protein
CAT#: TP320361
Recombinant protein of human v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220361 protein sequence
Red=Cloning site Green=Tags(s) MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRP NTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAK PKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFL TALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENL MLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFY NQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001014432 |
Locus ID | 207 |
UniProt ID | P31749, B0LPE5 |
Cytogenetics | 14q32.33 |
Refseq Size | 2878 |
Refseq ORF | 1440 |
Synonyms | AKT; PKB; PKB-ALPHA; PRKBA; RAC; RAC-ALPHA |
Summary | This gene encodes one of the three members of the human AKT serine-threonine protein kinase family which are often referred to as protein kinase B alpha, beta, and gamma. These highly similar AKT proteins all have an N-terminal pleckstrin homology domain, a serine/threonine-specific kinase domain and a C-terminal regulatory domain. These proteins are phosphorylated by phosphoinositide 3-kinase (PI3K). AKT/PI3K forms a key component of many signalling pathways that involve the binding of membrane-bound ligands such as receptor tyrosine kinases, G-protein coupled receptors, and integrin-linked kinase. These AKT proteins therefore regulate a wide variety of cellular functions including cell proliferation, survival, metabolism, and angiogenesis in both normal and malignant cells. AKT proteins are recruited to the cell membrane by phosphatidylinositol 3,4,5-trisphosphate (PIP3) after phosphorylation of phosphatidylinositol 4,5-bisphosphate (PIP2) by PI3K. Subsequent phosphorylation of both threonine residue 308 and serine residue 473 is required for full activation of the AKT1 protein encoded by this gene. Phosphorylation of additional residues also occurs, for example, in response to insulin growth factor-1 and epidermal growth factor. Protein phosphatases act as negative regulators of AKT proteins by dephosphorylating AKT or PIP3. The PI3K/AKT signalling pathway is crucial for tumor cell survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating AKT1 which then phosphorylates and inactivates components of the apoptotic machinery. AKT proteins also participate in the mammalian target of rapamycin (mTOR) signalling pathway which controls the assembly of the eukaryotic translation initiation factor 4F (eIF4E) complex and this pathway, in addition to responding to extracellular signals from growth factors and cytokines, is disregulated in many cancers. Mutations in this gene are associated with multiple types of cancer and excessive tissue growth including Proteus syndrome and Cowden syndrome 6, and breast, colorectal, and ovarian cancers. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2020] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase |
Protein Pathways | Acute myeloid leukemia, Adipocytokine signaling pathway, Apoptosis, B cell receptor signaling pathway, Chemokine signaling pathway, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Glioma, Insulin signaling pathway, Jak-STAT signaling pathway, MAPK signaling pathway, Melanoma, mTOR signaling pathway, Neurotrophin signaling pathway, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Progesterone-mediated oocyte maturation, Prostate cancer, Renal cell carcinoma, Small cell lung cancer, T cell receptor signaling pathway, Tight junction, Toll-like receptor signaling pathway, VEGF signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401580 | AKT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423056 | AKT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423057 | AKT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC425358 | AKT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401580 | Transient overexpression lysate of v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 1 |
USD 436.00 |
|
LY423056 | Transient overexpression lysate of v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 3 |
USD 436.00 |
|
LY423057 | Transient overexpression lysate of v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 2 |
USD 665.00 |
|
LY425358 | Transient overexpression lysate of v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 2 |
USD 436.00 |
|
PH301850 | AKT1 MS Standard C13 and N15-labeled recombinant protein (NP_001014431) |
USD 3,255.00 |
|
PH320257 | AKT1 MS Standard C13 and N15-labeled recombinant protein (NP_005154) |
USD 3,255.00 |
|
PH320361 | AKT1 MS Standard C13 and N15-labeled recombinant protein (NP_001014432) |
USD 3,255.00 |
|
TP301850 | Recombinant protein of human v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 3, 20 µg |
USD 867.00 |
|
TP320257 | Recombinant protein of human v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 1, 20 µg |
USD 867.00 |
|
TP700055 | Recombinant protein of human v-akt murine thymoma viral oncogene homolog 1 (AKT1) mutant (E17K), transcript variant 1 |
USD 867.00 |
|
TP700060 | Recombinant protein of human v-akt murine thymoma viral oncogene homolog 1 (AKT1 mutant S473D), transcript variant 1, with C-terminal MYC/DDK tag, expressed in human cells, 20ug |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review