CYP2A7 (NM_030589) Human Recombinant Protein
CAT#: TP314234
Recombinant protein of human cytochrome P450, family 2, subfamily A, polypeptide 7 (CYP2A7), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214234 representing NM_030589
Red=Cloning site Green=Tags(s) MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLNTEHICDSIMKVSQGVAFSNG ERAKQLLRFAIATLRDFGVGKRGIEERIQEESGFLIEAIRSTHGANIDPTFFLSRTVSNVISSIVFGDRF DYEDKEFLSLLSMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFKLLQGLEDFIAKKVEHNQRTLDP NSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFIAGTETVSTTLRYGFLLLMKHPEVEAKVHEEI DRVIGKNRQPKFEDRTKMPYMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVFPMLGSVLRD PSFFSNPQDFNPQHFLDDKGQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDI DVSPKHVVFATIPRNYTMSFLPR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_085079 |
Locus ID | 1549 |
UniProt ID | P20853, F8W816 |
Cytogenetics | 19q13.2 |
Refseq Size | 2128 |
Refseq ORF | 1329 |
Synonyms | CPA7; CPAD; CYP2A; CYPIIA7; P450-IIA4 |
Summary | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum; its substrate has not yet been determined. This gene, which produces two transcript variants, is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, P450, Transmembrane |
Protein Pathways | Caffeine metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Retinol metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410788 | CYP2A7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC424531 | CYP2A7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY410788 | Transient overexpression lysate of cytochrome P450, family 2, subfamily A, polypeptide 7 (CYP2A7), transcript variant 2 |
USD 665.00 |
|
LY424531 | Transient overexpression lysate of cytochrome P450, family 2, subfamily A, polypeptide 7 (CYP2A7), transcript variant 1 |
USD 665.00 |
|
PH313527 | CYP2A7 MS Standard C13 and N15-labeled recombinant protein (NP_000755) |
USD 3,255.00 |
|
PH314234 | CYP2A7 MS Standard C13 and N15-labeled recombinant protein (NP_085079) |
USD 3,255.00 |
|
TP313527 | Recombinant protein of human cytochrome P450, family 2, subfamily A, polypeptide 7 (CYP2A7), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review