Aldehyde dehydrogenase 10 (ALDH3A2) (NM_001031806) Human Recombinant Protein
CAT#: TP300648
Recombinant protein of human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200648 protein sequence
Red=Cloning site Green=Tags(s) MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQEVITVLGEIDF MLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQPLIGAIAAGNAVIIKPSELS ENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDHIFYTGNTAVGKIVMEAAAKHLTPVTLELGG KSPCYIDKDCDLDIVCRRITWGKYMNCGQTCIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYE RIINLRHFKRILSLLEGQKIAFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAIN FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFS HQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKEKLGLLLLTFLGIVAAVLVKKYQAVLRRK ALLIFLVVHRLRWSSKQR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 57.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001026976 |
Locus ID | 224 |
UniProt ID | P51648 |
Cytogenetics | 17p11.2 |
Refseq Size | 3823 |
Refseq ORF | 1524 |
Synonyms | ALDH10; FALDH; SLS |
Summary | Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This gene product catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acid. Mutations in the gene cause Sjogren-Larsson syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Arginine and proline metabolism, Ascorbate and aldarate metabolism, beta-Alanine metabolism, Butanoate metabolism, Fatty acid metabolism, Glycerolipid metabolism, Glycolysis / Gluconeogenesis, Histidine metabolism, Limonene and pinene degradation, Lysine degradation, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism, Tryptophan metabolism, Valine, leucine and isoleucine degradation |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422196 | ALDH3A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424751 | ALDH3A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC424995 | ALDH3A2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY422196 | Transient overexpression lysate of aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 1 |
USD 436.00 |
|
LY424751 | Transient overexpression lysate of aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2 |
USD 665.00 |
|
LY424995 | Transient overexpression lysate of aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2 |
USD 436.00 |
|
PH300648 | ALDH3A2 MS Standard C13 and N15-labeled recombinant protein (NP_001026976) |
USD 3,255.00 |
|
PH323398 | ALDH3A2 MS Standard C13 and N15-labeled recombinant protein (NP_000373) |
USD 3,255.00 |
|
TP323398 | Recombinant protein of human aldehyde dehydrogenase 3 family, member A2 (ALDH3A2), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review