Apc11 (ANAPC11) (NM_001002244) Human Recombinant Protein
CAT#: TP300097
Recombinant protein of human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200097 protein sequence
Red=Cloning site Green=Tags(s) MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCPLHGESISRCLGWCPQPVPVLGGRAHPQVPINT ASPTPGQHTGSLMSREESSRSPDPTPPALDQETSSLLRCTSPWCLDHSCDLFGITDQVSADGPRACRQGA RRRLPAGVGPVLPLLPHALHPQVAARTAGAAALPHVPPGMEVQGVRPDLALAGGAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001002244 |
Locus ID | 51529 |
UniProt ID | Q9NYG5, A0A024R8S1 |
Cytogenetics | 17q25.3 |
Refseq Size | 1186 |
Refseq ORF | 588 |
Synonyms | APC11; Apc11p; HSPC214 |
Summary | Together with the cullin protein ANAPC2, constitutes the catalytic component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. May recruit the E2 ubiquitin-conjugating enzymes to the complex.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413973 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424181 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424182 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424183 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424184 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424185 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424186 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413973 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 2 |
USD 436.00 |
|
LY424181 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 1 |
USD 436.00 |
|
LY424182 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 3 |
USD 436.00 |
|
LY424183 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 4 |
USD 436.00 |
|
LY424184 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 5 |
USD 436.00 |
|
LY424185 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 6 |
USD 436.00 |
|
LY424186 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 7 |
USD 436.00 |
|
PH300097 | ANAPC11 MS Standard C13 and N15-labeled recombinant protein (NP_001002244) |
USD 3,255.00 |
|
TP760669 | Purified recombinant protein of Human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review