CSK (NM_001127190) Human Mass Spec Standard
CAT#: PH325740
CSK MS Standard C13 and N15-labeled recombinant protein (NP_001120662)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225740 |
Predicted MW | 50.7 kDa |
Protein Sequence |
>RC225740 protein sequence
Red=Cloning site Green=Tags(s) MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREG VKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSI DEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVM LGDYRGNKVAVKCIKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRS RGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPV KWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK NCWHLDAAMRPSFLQLREQLEHIKTHELHL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001120662 |
RefSeq Size | 2236 |
RefSeq ORF | 1350 |
Locus ID | 1445 |
UniProt ID | P41240, B2R6Q4, A8K3B6 |
Cytogenetics | 15q24.1 |
Summary | The protein encoded by this gene is involved in multiple pathways, including the regulation of Src family kinases. It plays an important role in T-cell activation through its association with the protein encoded by the protein tyrosine phosphatase, non-receptor type 22 (PTPN22) gene. This protein also phosphorylates C-terminal tyrosine residues on multiple substrates, including the protein encoded by the SRC proto-oncogene, non-receptor tyrosine kinase gene. Phosphorylation suppresses the kinase activity of the Src family tyrosine kinases. An intronic polymorphism (rs34933034) in this gene has been found to affect B-cell activation and is associated with systemic lupus erythematosus (SLE). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Chemokine signaling pathway, Epithelial cell signaling in Helicobacter pylori infection, Neurotrophin signaling pathway, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401395 | CSK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC426695 | CSK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401395 | Transient overexpression lysate of c-src tyrosine kinase (CSK), transcript variant 1 |
USD 436.00 |
|
LY426695 | Transient overexpression lysate of c-src tyrosine kinase (CSK), transcript variant 2 |
USD 436.00 |
|
PH310758 | CSK MS Standard C13 and N15-labeled recombinant protein (NP_004374) |
USD 3,255.00 |
|
TP310758 | Recombinant protein of human c-src tyrosine kinase (CSK), transcript variant 1, 20 µg |
USD 867.00 |
|
TP325740 | Recombinant protein of human c-src tyrosine kinase (CSK), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review