RFXANK (NM_003721) Human Mass Spec Standard
CAT#: PH320744
RFXANK MS Standard C13 and N15-labeled recombinant protein (NP_003712)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220744 |
Predicted MW | 28.1 kDa |
Protein Sequence |
>RC220744 protein sequence
Red=Cloning site Green=Tags(s) MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPVNPEPDASVSSPQAGSSLKHS TTLTNRQRGNEVSALPATLDSLSIHQLAAQGELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETV RFLLEWGADPHILAKERESALSLASTGGYTDIVGLLLERDVDINIYDWNGGTPLLYAVRGNHVKCVEALL ARGADLTTEADSGYTPMDLAVALGYRKVQQVIENHILKLFQSNLVPADPE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003712 |
RefSeq Size | 1455 |
RefSeq ORF | 780 |
Synonyms | ANKRA1; BLS; F14150_1; RFX-B |
Locus ID | 8625 |
UniProt ID | O14593, A0A024R7M1 |
Cytogenetics | 19p13.11 |
Summary | Major histocompatibility (MHC) class II molecules are transmembrane proteins that have a central role in development and control of the immune system. The protein encoded by this gene, along with regulatory factor X-associated protein and regulatory factor-5, forms a complex that binds to the X box motif of certain MHC class II gene promoters and activates their transcription. Once bound to the promoter, this complex associates with the non-DNA-binding factor MHC class II transactivator, which controls the cell type specificity and inducibility of MHC class II gene expression. This protein contains ankyrin repeats involved in protein-protein interactions. Mutations in this gene have been linked to bare lymphocyte syndrome type II, complementation group B. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Antigen processing and presentation, Primary immunodeficiency |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408725 | RFXANK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC418474 | RFXANK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408725 | Transient overexpression lysate of regulatory factor X-associated ankyrin-containing protein (RFXANK), transcript variant 2 |
USD 436.00 |
|
LY418474 | Transient overexpression lysate of regulatory factor X-associated ankyrin-containing protein (RFXANK), transcript variant 1 |
USD 436.00 |
|
TP320744 | Recombinant protein of human regulatory factor X-associated ankyrin-containing protein (RFXANK), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review