Von Hippel Lindau (VHL) (NM_000551) Human Mass Spec Standard
CAT#: PH316151
VHL MS Standard C13 and N15-labeled recombinant protein (NP_000542)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216151 |
Predicted MW | 24 kDa |
Protein Sequence |
>RC216151 representing NM_000551
Red=Cloning site Green=Tags(s) MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSRE PSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSL NVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQR MGD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000542 |
RefSeq Size | 2968 |
RefSeq ORF | 639 |
Synonyms | HRCA1; pVHL; RCA1; VHL1 |
Locus ID | 7428 |
UniProt ID | P40337, A0A024R2F2 |
Cytogenetics | 3p25.3 |
Summary | Von Hippel-Lindau syndrome (VHL) is a dominantly inherited familial cancer syndrome predisposing to a variety of malignant and benign tumors. A germline mutation of this gene is the basis of familial inheritance of VHL syndrome. The protein encoded by this gene is a component of the protein complex that includes elongin B, elongin C, and cullin-2, and possesses ubiquitin ligase E3 activity. This protein is involved in the ubiquitination and degradation of hypoxia-inducible-factor (HIF), which is a transcription factor that plays a central role in the regulation of gene expression by oxygen. RNA polymerase II subunit POLR2G/RPB7 is also reported to be a target of this protein. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Pathways in cancer, Renal cell carcinoma, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400188 | VHL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404985 | VHL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400188 | Transient overexpression lysate of von Hippel-Lindau tumor suppressor (VHL), transcript variant 1 |
USD 436.00 |
|
LY404985 | Transient overexpression lysate of von Hippel-Lindau tumor suppressor (VHL), transcript variant 2 |
USD 436.00 |
|
TP316151 | Recombinant protein of human von Hippel-Lindau tumor suppressor (VHL), transcript variant 1, 20 µg |
USD 867.00 |
|
TP760451 | Purified recombinant protein of Human von Hippel-Lindau tumor suppressor (VHL), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review