GMPPA (NM_205847) Human Mass Spec Standard
CAT#: PH312726
GMPPA MS Standard C13 and N15-labeled recombinant protein (NP_995319)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212726 |
Predicted MW | 46.3 kDa |
Protein Sequence |
>RC212726 protein sequence
Red=Cloning site Green=Tags(s) MLKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQPDEPLTQFLE AAQQEFNLPVRYLQEFAPLGTGGGLYHFRDQILAGSPEAFFVLNADVCSDFPLSAMLEAHRRQRHPFLLL GTTANRTQSLNYGCIVENPQTHEVLHYVEKPSTFISDIINCGIYLFSPEALKPLRDVFQRNQQDGQLEDS PGLWPGAGTIRLEQDVFSALAGQGQIYVHLTDGIWSQIKSAGSALYASRLYLSRYQDTHPERLAKHTPGG PWIRGNVYIHPTAKVAPSAVLGPNVSIGKGVTVGEGVRLRESIVLHGATLQEHTCVLHSIVGWGSTVGRW ARVEGTPSDPNPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_995319 |
RefSeq Size | 1845 |
RefSeq ORF | 1260 |
Synonyms | AAMR |
Locus ID | 29926 |
UniProt ID | Q96IJ6, A0A384MDS7 |
Cytogenetics | 2q35 |
Summary | This gene is thought to encode a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides. [provided by RefSeq, Jul 2008] |
Protein Pathways | Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403717 | GMPPA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC415641 | GMPPA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC429378 | GMPPA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403717 | Transient overexpression lysate of GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 2 |
USD 665.00 |
|
LY415641 | Transient overexpression lysate of GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 1 |
USD 436.00 |
|
LY429378 | Transient overexpression lysate of GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 1 |
USD 436.00 |
|
TP312726 | Recombinant protein of human GDP-mannose pyrophosphorylase A (GMPPA), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review