CNPase (CNP) (NM_033133) Human Mass Spec Standard

CAT#: PH307038

CNP MS Standard C13 and N15-labeled recombinant protein (NP_149124)

Product Images

Coomassie blue staining of purified CNP protein (Cat# TP307038). The protein was produced from HEK293T cells transfected with CNP cDNA clone (Cat# RC207038) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207038
• Predicted MW: 47.6 kDa
• Protein Sequence:
  Sequence Link

  >RC207038 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNRGFSRKSHTFLPKIFFRKMSSSGAKDKPELQFPFLQDEDTVATLLECKTLFILRGLPGSGKSTLARVI
  VDKYRDGTKMVSADAYKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLFEMADQ
  YQYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFL
  EELGNHKAFKKELRQFVPGDEPREKMDLVTYFGKRPPGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSK
  AFTLTISALFVTPKTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITLGCAADVEAVQTGLDLLE
  ILRQEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTI
  I
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_149124
• RefSeq Size: 5222
• RefSeq ORF: 1263
• Synonyms: CNP1
• Locus ID: 1267
• UniProt ID: P09543
• Cytogenetics: 17q21.2
• Summary: May participate in RNA metabolism in the myelinating cell, CNP is the third most abundant protein in central nervous system myelin.[UniProtKB/Swiss-Prot Function]